Overview

  • Product name
  • Description
    Rabbit polyclonal to RPL18A
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment within Human RPL18A aa 120-176. The exact sequence is proprietary.
    Sequence:

    RAHSIQIMKVEEIAASKCRRPAVKQFHDSKIKFPLPHRVLRRQHKPRFTT KRPNTFF


    Database link: Q02543

  • Positive control
    • Human pancreas tissue, Human cell line RT-4 and Human cell line U-251MG sp

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab188131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/250 - 1/500. Predicted molecular weight: 21 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance
    Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL18A belongs to the L18AE family of ribosomal proteins. It is located in the cytoplasm. This gene is co-transcribed with the U68 snoRNA, which is located in its third intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
  • Cellular localization
    Cytosolic large ribosomal subunit
  • Database links
  • Alternative names
    • 2510019J09Rik antibody
    • 60S ribosomal protein L18a antibody
    • L18A antibody
    • MGC72957 antibody
    • Ribosomal protein L18A antibody
    • Ribosomal protein L18a like protein antibody
    see all

Images

  • All lanes : Anti-RPL18A antibody (ab188131) at 1/250 dilution

    Lane 1 : Human cell line RT-4
    Lane 2 : Human cell line U-251MG sp

    Predicted band size: 21 kDa

  • Immunohistochemical analysis of Human pancreas tissue, labeling RPL18A using ab188131 at a 1/100 dilution.

References

ab188131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up