Overview

  • Product name
  • Description
    Rabbit polyclonal to RPL35
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human RPL35 aa 51-100.
    Sequence:

    RKSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEE


    Database link: P42766

  • Positive control
    • Human brain cortex tissue; HeLa, Jurkat, COLO and 293 cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 0.87% Sodium chloride, 49% PBS

    PBS (without Mg2+, Ca2+)
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab190162 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 10 µg/ml.
WB 1/500 - 1/1000. Predicted molecular weight: 15 kDa.

Target

Images

  • All lanes : Anti-RPL35 antibody (ab190162) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : Jurkat cell lysate
    Lane 3 : COLO cell lysate
    Lane 4 : 293 cell lysate
    Lane 5 : HeLa cell lysate with Synthesized peptide


    Predicted band size : 15 kDa
  • Immunohistochemical staining of Human brain cortex tissue labeling RPL35 using ab190162 at 10 µg/ml.

References

This product has been referenced in:
  • Li C  et al. Proteomic Analysis of Liver Proteins in a Rat Model of Chronic Restraint Stress-Induced Depression. Biomed Res Int 2017:7508316 (2017). Read more (PubMed: 28293639) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190162.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up