Overview

  • Product name
  • Description
    Rabbit polyclonal to RPL6
  • Tested applications
    Suitable for: WBmore details
    Unsuitable for: IP
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Dog, Pig, Non human primates
  • Immunogen

    Synthetic peptide within Human RPL6 aa 25-75. The exact sequence is proprietary. NP_000961.2.
    Sequence:

    GKVKKGNLKAKKPKKGKPHCSRNPVLVRGIGRYSRSAMYSRKAMYKRKYS A


    Database link: Q02878

  • Positive control
    • HeLa, 293T and Jurkat whole cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 33 kDa.
  • Application notes
    Is unsuitable for IP.
  • Target

    Images

    • All lanes : Anti-RPL6 antibody (ab176705) at 0.04 µg/ml

      Lane 1 : 293T whole cell lysate at 50 µg
      Lane 2 : 293T whole cell lysate at 15 µg
      Lane 3 : HeLa whole cell lysate at 50 µg
      Lane 4 : Jurkat whole cell lysate at 50 µg

      Developed using the ECL technique

      Predicted band size : 33 kDa


      Exposure time : 10 seconds

    References

    ab176705 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab176705.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up