Overview

  • Product name
  • Description
    Rabbit polyclonal to RPLP0
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken, Cow, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human RPLP0 aa 1-317. (With tag; BC000087).
    Sequence:

    MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGK AVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRD MLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGITTKISRG TIEILSDVQLIKTGDKVGASEATLLNMLNISPFSFGLVIQQVFDNGSIYN PEVLDITEETLHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGYKRVLA LSVETDYTFPLAEKVKAFLADPSAFVAAAPVAAATTAAPAAAAAPAKVEA KEESEESDEDMGFGLFD


    Database link: P05388

  • Positive control
    • HeLa, 293T, A431 and Jurkat cell lysates; Human liver cancer tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.30
    Preservative: 0.05% Sodium azide
    Constituents: 50% Glycerol, 49% PBS

    Note: PBS without Mg2+ and Ca2+.
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab182766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 34 kDa.

Target

Images

  • Immunohistochemical analysis of paraffin-embedded Human liver cancer tissue labeling RPLP0 with ab182766 at 1/40 dilution (left panel). Right panel is treated with the immunogen.

  • All lanes : Anti-RPLP0 antibody (ab182766) at 1/600 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : 293T cell lysate
    Lane 3 : A431 cell lysate
    Lane 4 : Jurkat cell lysate

    Lysates/proteins at 40 µg per lane.

    Secondary
    All lanes : Goat anti Rabbit IgG - H&L (HRP) at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 34 kDa


    Exposure time: 1 minute


    Gel: 10% SDS-PAGE

References

ab182766 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up