Overview

  • Product nameAnti-RPS3 antibody
    See all RPS3 primary antibodies
  • Description
    Rabbit polyclonal to RPS3
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 191-240 (

    PWDPTGKIGPKKPLPDHVSIVEPKDEILPTTPISEQKGGKPEPPAMPQPV

    ) of Human RPS3 (P23396).

  • Positive control
    • Human fetal kidney lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab125372 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 27 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Sequence similaritiesBelongs to the ribosomal protein S3P family.
    Contains 1 KH type-2 domain.
  • Cellular localizationCytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
  • Information by UniProt
  • Database links
  • Alternative names
    • 40S ribosomal protein S3 antibody
    • fb13d09 antibody
    • FLJ26283 antibody
    • FLJ27450 antibody
    • IMR 90 ribosomal protein S3 antibody
    • MGC56088 antibody
    • MGC87870 antibody
    • OTTHUMP00000229804 antibody
    • OTTHUMP00000229805 antibody
    • OTTHUMP00000229874 antibody
    • OTTHUMP00000229877 antibody
    • OTTHUMP00000229878 antibody
    • OTTHUMP00000229879 antibody
    • OTTHUMP00000229880 antibody
    • OTTHUMP00000229882 antibody
    • OTTHUMP00000229883 antibody
    • OTTHUMP00000229886 antibody
    • Ribosomal protein S3 antibody
    • rps3 antibody
    • RS3_HUMAN antibody
    • S3 antibody
    • wu:fb13d09 antibody
    • zgc:56088 antibody
    see all

Anti-RPS3 antibody images

  • Anti-RPS3 antibody (ab125372) at 1 µg/ml + Human fetal kidney lysate at 10 µg

    Predicted band size : 27 kDa

References for Anti-RPS3 antibody (ab125372)

ab125372 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab125372.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"