Overview

  • Product nameAnti-RPS3A antibody
    See all RPS3A primary antibodies
  • Description
    Rabbit polyclonal to RPS3A
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Caenorhabditis elegans, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (PAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF K) of Human RPS3A (NP_000997).

  • Positive control
    • Human fetal liver lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 30 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-RPS3A antibody images

  • Anti-RPS3A antibody (ab90701) at 1 µg/ml + Human fetal liver lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 30 kDa
  • Anti-RPS3A antibody (ab90701) at 1/1000 dilution + Arabidopsis thaliana extract at 30 µg

    Secondary
    HRP anti-rabbit at 1/15000 dilution

    Predicted band size : 30 kDa


    Exposure time : 1 minute

References for Anti-RPS3A antibody (ab90701)

ab90701 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90701.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"