Overview

  • Product nameAnti-Rpt5 antibody
    See all Rpt5 primary antibodies
  • Description
    Mouse polyclonal to Rpt5
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Saccharomyces cerevisiae
  • Immunogen

    Fusion protein:

    EKIKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSESTTQGGNVNLD NTAVGKAAVVKTSSRQTVFLPMVGLVDPDKLKPNDLVGVNKDSYLILDTL

    , corresponding to amino acids 60-159 of S. cerevisiae Rpt5.

  • General notesProduced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferConstituents: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notesThis antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab21745 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 48 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • RelevanceIn the yeast S. cerevisiae 12 different members of a novel gene family of putative ATPases have been identified and characterised. Due to their similarities to TBP1, a human immunodeficiency tat binding protein, they have been designated the YTA family or yeast tat binding analogues. All share a region of high similarity of approximately 300 amino acids in length. Rpt5p or YTA1 ,is one of six ATPases of the 19S regulatory particle of the 26S proteasome involved in the degradation of ubiquitinated substrates.
  • Cellular localizationNuclear
  • Database links
    • Alternative names
      • 26S protease regulatory subunit 6A antibody
      • TAT binding protein homolog 1 antibody
      • TBP1 antibody
      • YTA1 antibody

    Anti-Rpt5 antibody images

    • All lanes : Anti-Rpt5 antibody (ab21745) at 1/1000 dilution

      Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
      Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

      Secondary
      Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

      Performed under reducing conditions.

      Predicted band size : 48 kDa

    References for Anti-Rpt5 antibody (ab21745)

    ab21745 has not yet been referenced specifically in any publications.

    Product Wall

    There are currently no Abreviews or Questions for ab21745.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"