Overview

  • Product nameAnti-Rpt5 antibody
    See all Rpt5 primary antibodies
  • Description
    Rabbit polyclonal to Rpt5
  • Specificityab22676 reacts with 19S regulator ATPase subunit Rpt5p (Yta1).
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Saccharomyces cerevisiae, Arabidopsis thaliana, Fungi
  • Immunogen

    Recombinant His6 tagged fragment:

    MATLEELDAQTLPGDDELDQEILNLSTQELQTRAKLLDNEIRIFRSELQR LSHENNVMLEKIKDNKEKIKNNRQLPYLVANVVEVMDMNEIEDKENSEST

    , corresponding to N terminal amino acids 1-100 of S. cerevisiae Rpt5.

  • Positive control
    • Yeast 26S proteasome

Properties

Applications

Our Abpromise guarantee covers the use of ab22676 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
  • Application notesWB: 1/10000 - 1/50000. Detects a band of approximately 48 kDa (predicted molecular weight: 48 kDa).
    Notes: Dilute to working strength with phosphate buffered saline pH 7.2-7.4 and 1% normal goat serum (if a goat anti-rabbit IgG linker antibody is to be used).

    Not tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • RelevanceIn the yeast S. cerevisiae 12 different members of a novel gene family of putative ATPases have been identified and characterised. Due to their similarities to TBP1, a human immunodeficiency tat binding protein, they have been designated the YTA family or yeast tat binding analogues. All share a region of high similarity of approximately 300 amino acids in length. Rpt5p or YTA1 ,is one of six ATPases of the 19S regulatory particle of the 26S proteasome involved in the degradation of ubiquitinated substrates.
    • Cellular localizationNuclear
    • Database links
      • Alternative names
        • 26S protease regulatory subunit 6A antibody
        • TAT binding protein homolog 1 antibody
        • TBP1 antibody
        • YTA1 antibody

      Anti-Rpt5 antibody images

      • Anti-Rpt5 antibody (ab22676) at 1/25000 dilution (PVDF blotting membrane)
        Developed using the ECL technique

        Performed under reducing conditions.

        Predicted band size : 48 kDa
        Observed band size : 48 kDa


        Exposure time : 1 minute

      References for Anti-Rpt5 antibody (ab22676)

      This product has been referenced in:
      • Wang Y  et al. Repression of MYBL2 by Both microRNA858a and HY5 Leads to the Activation of Anthocyanin Biosynthetic Pathway in Arabidopsis. Mol Plant 9:1395-1405 (2016). Read more (PubMed: 27450422) »

      See 1 Publication for this product

      Product Wall

      There are currently no Abreviews or Questions for ab22676.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"