Anti-RRAS2 antibody - C-terminal (ab182264)

Overview

  • Product name
    Anti-RRAS2 antibody - C-terminal
    See all RRAS2 primary antibodies
  • Description
    Rabbit polyclonal to RRAS2 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide within Human RRAS2 aa 155-204 (C terminal). The exact sequence is proprietary.
    Sequence:

    EASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF


    Database link: P62070

  • Positive control
    • Human Esophagus Tumor lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab182264 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 23 kDa.

Target

  • Function
    It is a plasma membrane-associated GTP-binding protein with GTPase activity. Might transduce growth inhibitory signals across the cell membrane, exerting its effect through an effector shared with the Ras proteins but in an antagonistic fashion.
  • Tissue specificity
    Ubiquitously present in all tissues examined, with the highest levels in heart, placenta, and skeletal muscle. Moderate levels in lung and liver; low levels in brain, kidney, and pancreas.
  • Involvement in disease
    Ovarian cancer
  • Sequence similarities
    Belongs to the small GTPase superfamily. Ras family.
  • Post-translational
    modifications
    May be post-translationally modified by both palmitoylation and polyisoprenylation.
  • Cellular localization
    Cell membrane. Inner surface of plasma membrane possibly with attachment requiring acylation of the C-terminal cysteine (By similarity with RAS).
  • Information by UniProt
  • Database links
  • Alternative names
    • C86394 antibody
    • Oncogene RRAS2 antibody
    • Oncogene TC21 antibody
    • Ras like protein TC21 antibody
    • Ras related protein R Ras2 antibody
    • Ras-like protein TC21 antibody
    • Ras-related protein R-Ras2 antibody
    • Related RAS viral (r ras) oncogene homolog 2 antibody
    • Related RAS viral oncogene homolog 2 antibody
    • RRAS 2 antibody
    • RRAS2 antibody
    • RRAS2_HUMAN antibody
    • TC 21 antibody
    • TC21 antibody
    • Teratocarcinoma oncogene antibody
    • Teratocarcinoma oncogene TC21 antibody
    see all

Images

  • Anti-RRAS2 antibody - C-terminal (ab182264) at 1 µg/ml + Human Esophagus Tumor lysate at 10 µg

    Predicted band size: 23 kDa

References

ab182264 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182264.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up