Overview

  • Product name
  • Description
    Rabbit polyclonal to RRS1
  • Tested applications
    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human RRS1 aa 207-280.
    Sequence:

    LHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRKFQP LFGDFAAEKKNQLELLRVMNSKKP


    Database link: Q15050

  • Positive control
    • Human vagina tissue; RT-4 and U-25 MG sp cell lysates; U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab188161 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/1000 - 1/2500. Predicted molecular weight: 41 kDa.

Target

Images

  • Immunofluorescence analysis of Human cell line U-2 OS labeling RRS1 with ab188161 at 4 µg/ml.

  • All lanes : Anti-RRS1 antibody (ab188161) at 1/1000 dilution

    Lane 1 : RT-4 cell lysates
    Lane 2 : U-251 MG sp cell lysates

    Developed using the ECL technique

    Predicted band size : 41 kDa
  • Immunohistochemical analysis of paraffin-embedded Human vagina tissue labeling RRS1 with ab188161 at 1/1000 dilution.

References

ab188161 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188161.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up