Overview

  • Product name
    Anti-RSPH10B antibody
  • Description
    Rabbit polyclonal to RSPH10B
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 288-337 (FVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN D) of Human RSPH10B (NP_775836)

  • Positive control
    • Jurkat cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90954 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 101 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-RSPH10B antibody images

  • Anti-RSPH10B antibody (ab90954) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP goat anti rabbit IgG at 1/50000 dilution

    Predicted band size : 101 kDa

References for Anti-RSPH10B antibody (ab90954)

ab90954 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90954.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up