Overview

  • Product nameAnti-RTDR1 antibody
    See all RTDR1 primary antibodies
  • Description
    Rabbit polyclonal to RTDR1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 288-337 (

    ARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRAA

    ) of Human RTDR1 (NP_055248).

  • Positive control
    • Fetal muscle lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab90160 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 39 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Tissue specificityExpressed in adult cerebellum, spinal cord, spleen, skeletal muscle and some/5 out of 9 rhabdoid tumors. Detected in fetal brain, lung, liver and kidney.
  • Information by UniProt
  • Database links
  • Alternative names
    • 4933431K05Rik antibody
    • MCG5994, isoform CRA_b antibody
    • MGC16968 antibody
    • Rhabdoid tumor deletion region gene 1 antibody
    • Rhabdoid tumor deletion region protein 1 antibody
    • RTDR1 antibody
    • RTDR1_HUMAN antibody
    see all

Anti-RTDR1 antibody images

  • Anti-RTDR1 antibody (ab90160) at 1 µg/ml + Human fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 39 kDa

References for Anti-RTDR1 antibody (ab90160)

ab90160 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90160.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"