
  • Product nameAnti-RWDD4A antibody
    See all RWDD4A primary antibodies
  • Description
    Rabbit polyclonal to RWDD4A
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 2-51 (SANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEIS W) of Human RWDD4A (NP_689895)

  • Positive control
    • Human fetal intestine lysate


  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas


Our Abpromise guarantee covers the use of ab89737 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 21 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


Anti-RWDD4A antibody images

  • Anti-RWDD4A antibody (ab89737) at 1 µg/ml + Human fetal intestine lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 21 kDa
    Observed band size : 22 kDa (why is the actual band size different from the predicted?)

References for Anti-RWDD4A antibody (ab89737)

ab89737 has not yet been referenced specifically in any publications.

Product Wall

Application Western blot
Sample Human Cell lysate - whole cell (Human osteosarcoma U2OS cells)
Loading amount 120 µg
Specification Human osteosarcoma U2OS cells
Gel Running Conditions Reduced Denaturing (4-18% gel)
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C

Abcam user community

Verified customer

Submitted Apr 16 2012