Overview

  • Product name
    Anti-S100 alpha 6 antibody
    See all S100 alpha 6 primary antibodies
  • Description
    Rabbit polyclonal to S100 alpha 6
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Cow, Cat, Dog, Pig
  • Immunogen

    Recombinant full length protein corresponding to Human S100 alpha 6 aa 1-90. NCBI Accession No. NP_055439.1. Monomer was expressed in E coli.
    Sequence:

    MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQD AEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG


    Database link: P06703

  • Positive control
    • Human colon tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab189944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon tissue, labeling S100 alpha 6 using ab189944 at a 1/50 dilution.

References

ab189944 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up