Overview

  • Product nameAnti-S100A10 antibody
    See all S100A10 primary antibodies
  • Description
    Mouse monoclonal to S100A10
  • Tested applicationsSuitable for: Flow Cyt, WB, ELISAmore details
  • Species reactivity
    Reacts with: Rat, Human
    Predicted to work with: Mouse, Rabbit, Chicken, Cow, Pig, Rhesus monkey
  • Immunogen

    Recombinant full length protein corresponding to amino acids 1-98 (

    MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPL AVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK

    ), of Human S100A10 (AAH15973) with proprietary tag.

  • Positive control
    • HeLa cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab89438 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Flow Cyt Use 0.5µg for 106 cells. ab170191-Mouse monoclonal IgG2a, is suitable for use as an isotype control with this antibody.
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 11 kDa.
ELISA Use at an assay dependent concentration.

Target

  • FunctionBecause S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.
  • Sequence similaritiesBelongs to the S-100 family.
  • Information by UniProt
  • Database links
  • Alternative names
    • 42C antibody
    • AA409961 antibody
    • AL024248 antibody
    • Annexin II ligand antibody
    • Annexin II ligand, calpactin I, light polypeptide antibody
    • Annexin II, light chain antibody
    • ANX2L antibody
    • ANX2LG antibody
    • Ca[1] antibody
    • CAL12 antibody
    • CAL1L antibody
    • Calpactin I light chain antibody
    • Calpactin I, p11 subunit antibody
    • Calpactin-1 light chain antibody
    • Cellular ligand of annexin II antibody
    • CLP11 antibody
    • GP11 antibody
    • MGC111133 antibody
    • Nerve growth factor-induced protein 42C antibody
    • OTTHUMP00000015269 antibody
    • OTTHUMP00000015270 antibody
    • p10 antibody
    • p10 protein antibody
    • p11 antibody
    • Protein S100 A10 antibody
    • Protein S100-A10 antibody
    • S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)) antibody
    • S100 calcium binding protein A10 (calpactin) antibody
    • S100 calcium binding protein A10 antibody
    • S100 calcium-binding protein A10 antibody
    • S100a10 antibody
    • S10AA_HUMAN antibody
    see all

Anti-S100A10 antibody images

  • Anti-S100A10 antibody (ab89438) at 5 µg/ml + Recombinant protein used as the immunogen at 0.2 µg
    Developed using the ECL technique

    Predicted band size : 11 kDa
    Observed band size : 40 kDa (why is the actual band size different from the predicted?)
  • Anti-S100A10 antibody (ab89438) at 5 µg/ml + HeLa cell lysate at 50 µg

    Predicted band size : 11 kDa
    Observed band size : 11 kDa
  • Overlay histogram showing A431 cells stained with ab89438 (red line). The cells were fixed with 80% methanol (5 min) and then permeabilized with 0.1% PBS-Tween for 20 min. The cells were then incubated in 1x PBS / 10% normal goat serum / 0.3M glycine to block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab89438, 0.5µg/1x106 cells) for 30 min at 22ºC. The secondary antibody used was DyLight® 488 goat anti-mouse IgG (H+L) (ab96879) at 1/500 dilution for 30 min at 22ºC. Isotype control antibody (black line) was mouse IgG2a [ICIGG2A] (ab91361, 1µg/1x106 cells) used under the same conditions. Acquisition of >5,000 events was performed.

References for Anti-S100A10 antibody (ab89438)

This product has been referenced in:
  • Perez-Caballero L  et al. Early responses to deep brain stimulation in depression are modulated by anti-inflammatory drugs. Mol Psychiatry N/A:N/A (2013). Rat . Read more (PubMed: 23711979) »

See 1 Publication for this product

Product Wall

There are currently no Abreviews or Questions for ab89438.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"