Overview

  • Product nameAnti-SAA4 antibody
    See all SAA4 primary antibodies
  • Description
    Rabbit polyclonal to SAA4
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cow, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 80-129 (

    RVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKK

    ) of Human SAA4 (NP_006503).

  • Positive control
    • Human Fetal Stomach Lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99182 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 15 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMajor acute phase reactant. Apolipoprotein of the HDL complex.
  • Tissue specificityExpressed by the liver; secreted in plasma.
  • Sequence similaritiesBelongs to the SAA family.
  • Cellular localizationSecreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Amyloid A, serum, 4 antibody
    • C SAA antibody
    • C-SAA antibody
    • Constitutively expressed serum amyloid A protein antibody
    • CSAA antibody
    • SAA 4 antibody
    • Saa4 antibody
    • SAA4 protein antibody
    • SAA4_HUMAN antibody
    • Serum amyloid A 4 protein antibody
    • Serum amyloid A-4 protein antibody
    • Serum amyloid A4 constitutive antibody
    see all

Anti-SAA4 antibody images

  • Anti-SAA4 antibody (ab99182) at 1 µg/ml + Human Fetal Stomach Lysate at 10 µg

    Predicted band size : 15 kDa

References for Anti-SAA4 antibody (ab99182)

ab99182 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99182.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"