
  • Product nameAnti-SAE2 / UBA2 antibodySee all SAE2 / UBA2 primary antibodies ...
  • Description
    Rabbit polyclonal to SAE2 / UBA2
  • Specificityab22104 specifically recognises SAE2.
  • Tested applicationsWB more details
  • Species reactivity
    Reacts with: Mouse, Rat, Chicken, Human, Xenopus laevis, Zebrafish
  • Immunogen

    Synthetic peptide: ECHPKPTQRTFPGCTIRNTPSEPIHCIVWAKYLFNQLFGEEDADQEVSPD R, corresponding to amino acids 160/210 of Human SAE2 .

  • Positive control
    • HeLa cell lysate


  • FormLiquid
  • Storage instructionsStore at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: 0.05% Sodium Azide
    Constituents: 0.05% BSA, PBS
  • Concentration information loading...
  • PurityProtein G purified
  • Clonality Polyclonal
  • IsotypeIgG
  • Research Areas


Our Abpromise guarantee covers the use of ab22104 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB Use a concentration of 0.5 - 2 µg/ml. Detects a band of approximately 71 kDa.


  • FunctionThe heterodimer acts as a E1 ligase for SUMO1, SUMO2, SUMO3, and probably SUMO4. It mediates ATP-dependent activation of SUMO proteins followed by formation of a thioester bond between a SUMO protein and a conserved active site cysteine residue on UBA2/SAE2.
  • PathwayProtein modification; protein sumoylation.
  • Sequence similaritiesBelongs to the ubiquitin-activating E1 family.
  • Cellular localizationNucleus.
  • Target information above from: UniProt accession Q9UBT2 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links
  • Alternative names
    • Anthracycline associated resistance ARX antibody
    • Anthracycline-associated resistance ARX antibody
    • ARX antibody
    • FLJ13058 antibody
    • HRIHFB2115 antibody
    • SAE 2 antibody
    • SAE2 antibody
    • SAE2_HUMAN antibody
    • SUMO 1 activating enzyme subunit 2 antibody
    • SUMO activating enzyme subunit 2 antibody
    • SUMO-activating enzyme subunit 2 antibody
    • UBA2 antibody
    • UBA2 ubiquitin activating enzyme E1 homolog antibody
    • Ubiquitin like 1 activating enzyme E1B antibody
    • Ubiquitin like 2 activating enzyme E1B antibody
    • Ubiquitin like modifier activating enzyme 2 antibody
    • Ubiquitin-like 1-activating enzyme E1B antibody
    • UBLE1B antibody
    see all

Anti-SAE2 / UBA2 antibody images

References for Anti-SAE2 / UBA2 antibody (ab22104)

ab22104 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab22104.
Please use the links above to contact us or submit feedback about this product.