Overview

  • Product nameAnti-Salivary alpha amylase antibody
    See all Salivary alpha amylase primary antibodies
  • Description
    Mouse monoclonal to Salivary alpha amylase
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human, Recombinant Fragment
  • Immunogen

    Recombinant fragment corresponding to Human Salivary alpha amylase aa 172-246.
    Sequence:

    VRDCRLSGLLDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGD IKAILDKLHNLNSNWFPEGSKPFI

Properties

Applications

Our Abpromise guarantee covers the use of ab54765 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P
WB
  • Application notesWB: Use at a concentration of 1-5 µg/ml.
    IHC-P: Use at a concentration of 3 µg/ml.

    This antibody has only been tested in WB against the recombinant fragment used as immunogen. We have no data on the detection of endogenous protein.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • Sequence similaritiesBelongs to the glycosyl hydrolase 13 family.
    • Cellular localizationSecreted.
    • Information by UniProt
    • Database links
    • Alternative names
      • amylase, salivary, B antibody
      • 1 4 alpha D glucan glucanohydrolase antibody
      • 1 antibody
      • 1,4 alpha D glucan glucanohydrolase 2B antibody
      • 1,4-alpha-D-glucan glucanohydrolase 1 antibody
      • 4-alpha-D-glucan glucanohydrolase 1 antibody
      • Alpha amylase antibody
      • Alpha-amylase 1 antibody
      • AMY1 antibody
      • AMY1_HUMAN antibody
      • AMY1C antibody
      • AMY2 antibody
      • AMY2B antibody
      • AMY3 antibody
      • amylase, alpha 1A (salivary) antibody
      • Amylase, alpha 1B (salivary) antibody
      • amylase, alpha 1C (salivary) antibody
      • amylase, salivary, alpha-1A antibody
      • amylase, salivary, alpha-1B antibody
      • amylase, salivary, alpha-1C antibody
      • amylase, salivary, C antibody
      • glycogenase antibody
      • HXA antibody
      • PA antibody
      • Salivary alpha-amylase antibody
      • salivary amylase alpha 1A antibody
      • salivary amylase alpha 1B antibody
      • salivary amylase alpha 1C antibody
      see all

    Anti-Salivary alpha amylase antibody images

    • alpha Amylase antibody (ab54765) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human salivary gland.
    • Western blot against tagged recombinant protein immunogen using ab54765 alpha Amylase antibody at 1ug/ml. Predicted band size of immunogen is 34 kDa
    • Anti-Salivary alpha amylase antibody (ab54765) + Human pancreas

    References for Anti-Salivary alpha amylase antibody (ab54765)

    This product has been referenced in:
    • Ko SB  et al. Inflammation increases cells expressing ZSCAN4 and progenitor cell markers in the adult pancreas. Am J Physiol Gastrointest Liver Physiol 304:G1103-16 (2013). Read more (PubMed: 23599043) »

    See 1 Publication for this product

    Product Wall

    Thank you for your enquiry.

    I can confirm that ab77875 Salivary Amylase protein (Active)is indeed alpha amylase.

    Please note that regrettably these antibodies and this protein have not been tested and guaranteed in the lateral flo...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"