Overview

  • Product name
    Anti-Sar1 antibody
  • Description
    Rabbit polyclonal to Sar1
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-P, Flow Cytmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Cow, Pig, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human Sar1 aa 128-158 (internal sequence) conjugated to Keyhole Limpet Haemocyanin (KLH).
    Sequence:

    PILILGNKIDRTDAISEEKLREIFGLYGQTT


    Database link: Q9NR31

  • Positive control
    • Human small intestine tissue; 293 and Mouse lung lysates; 293 cell lysate, transiently transfected with the Sar1 gene; NCI-H292 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab179929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500. Predicted molecular weight: 22 kDa.
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt 1/10 - 1/50.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

 

Target

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded Human small intestine tissue labeling Sar1 with ab179929 at 10 µg/ml.

  • All lanes : Anti-Sar1 antibody (ab179929) at 1/100 dilution

    Lane 1 : 293 lysate
    Lane 2 : Mouse lung lysate

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 22 kDa

  • All lanes : Anti-Sar1 antibody (ab179929) at 1/100 dilution

    Lane 1 : 293 cell lysate, nontransfected
    Lane 2 : 293 cell lysate, transiently transfected with the Sar1 gene.

    Lysates/proteins at 2 µg per lane.

    Predicted band size: 22 kDa

  • Flow cytometric analysis of NCI-H292 cells labeling Sar1 with ab179929 at 1/10 dilution (lower histogram) compared to a negative control cell (top histogram). FITC-conjugated goat anti-rabbit secondary antibodies were used for the analysis.

References

ab179929 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up