Overview

  • Product nameAnti-SARS Nsp2 antibody
  • Description
    Mouse polyclonal to SARS Nsp2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with SARS Coronavirus. Not yet tested in other species.
  • Immunogen

    Fusion protein:

    SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDML NPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPK Y

    , corresponding to amino acids 1-101 of SARS Nsp2.

  • General notesProduced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage bufferConstituents: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notesThis antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab21657 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 37 kDa.

This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.

Target

  • RelevanceThe main proteinase Nsp2 is responsible for the majority of cleavages as it cleaves the C terminus of replicase polyprotein at 11 sites. It recognizes substrates containing the core sequence [ILMVF]-Q-|-[SGACN]. It is inhibited by the substrate analog Cbz-Val-Asn-Ser-Thr-Leu-Gln-CMK.
  • Alternative names
    • 3C like proteinase antibody
    • 3CL PRO antibody
    • 3CLp antibody

Anti-SARS Nsp2 antibody images

  • All lanes : Anti-SARS Nsp2 antibody (ab21657) at 1/1000 dilution

    Lane 1 : 20ug of a total protein extract from E. coli with ~50ng to 100 ng of a GST fusion protein of an irrelevant antigen.
    Lane 2 : 20ug of a total protein extract from E. coli with ~50ng to 500ng of the antigen (GST-antigen fusion protein).

    Secondary
    Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 5000

    Performed under reducing conditions.

    Predicted band size : 37 kDa

References for Anti-SARS Nsp2 antibody (ab21657)

ab21657 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab21657.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"