Overview

  • Product name
  • Description
    Mouse polyclonal to SAV1
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Full length protein corresponding to Human SAV1 aa 1-383.
    Sequence:

    MLSRKKTKNEVSKPAEVQGKYVKKETSPLLRNLMPSFIRHGPTIPRRTDI CLPDSSPNAFSTSGDVVSRNQSFLRTPIQRTPHEIMRRESNRLSAPSYLA RSLADVPREYGSSQSFVTEVSFAVENGDSGSRYYYSDNFFDGQRKRPLGD RAHEDYRYYEYNHDLFQRMPQNQGRHASGIGRVAATSLGNLTNHGSEDLP LPPGWSVDWTMRGRKYYIDHNTNTTHWSHPLEREGLPPGWERVESSEFGT YYVDHTNKKAQYRHPCAPSVPRYDQPPPVTYQPQQTERNQSLLVPANPYH TAEIPDWLQVYARAPVKYDHILKWELFQLADLDTYQGMLKLLFMKELEQI VKMYEAYRQALLTELENRKQRQQWYAQQHGKNF


    Database link: NP_068590.1

  • Positive control
    • SAV1 transfected 293T cell lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity
    Protein A purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab172705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 45 kDa.

Target

  • Function
    Regulator of STK3/MST2 and STK4/MST1 in the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. SAV1 is required for STK3/MST2 and STK4/MST1 activation and promotes cell-cycle exit and terminal differentiation in developing epithelial tissues. Plays a role in centrosome disjunction by regulating the localization of NEK2 to centrosomes, and its ability to phosphorylate CROCC and CEP250. In conjunction with STK3/MST2, activates the transcriptional activity of ESR1 through the modulation of its phosphorylation.
  • Tissue specificity
    Ubiquitously expressed in adult tissues with highest expression in the pancreas, aorta and interventricular septum and lowest expression in skeletal muscle. Expression was higher in fetal than in the adult heart. Expressed in various cell lines.
  • Sequence similarities
    Contains 1 SARAH domain.
    Contains 2 WW domains.
  • Post-translational
    modifications
    Phosphorylated by STK3/MST2 and STK4/MST1. Phosphorylation is not required for SAV1 stability and may increase the number of protein binding sites on the scaffold molecule.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • 1700040G09Rik antibody
    • 45 kDa WW domain protein antibody
    • hWW 45 antibody
    • hWW45 antibody
    • Protein salvador homolog 1 antibody
    • salvador family WW domain containing protein 1 antibody
    • salvador homolog 1 (Drosophila) antibody
    • Salvador homolog 1 antibody
    • Salvador, Drosophila, homolog of antibody
    • SAV 1 antibody
    • SAV antibody
    • SAV1 antibody
    • SAV1_HUMAN antibody
    • WW 45 antibody
    • WW domain containing antibody
    • WW domain-containing adaptor 45 antibody
    • WW domain-containing protein, 45-KD antibody
    • WW45 antibody
    • WW45 protein antibody
    • WWP 4 antibody
    • WWP4 antibody
    see all

Images

  • All lanes : Anti-SAV1 antibody (ab172705) at 1 µg/ml

    Lane 1 : SAV1 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-mouse HRP at 1/2500 dilution

    Predicted band size: 45 kDa

References

ab172705 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172705.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up