Overview

  • Product name
  • Description
    Rabbit polyclonal to SCCPDH
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse
  • Immunogen

    Synthetic peptide, corresponding to a region within C terminal amino acids 324-373 (

    QGPTQKQIDAASFTLTFFGQGYSQGTGTDKNKPNIKICTQVKGPEAGYVA

    ) of human SCCPDH (NP_057086).

  • Positive control
    • Fetal muscle lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab81226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 47 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:62500.

Target

  • Pathway
    Amino-acid degradation; L-lysine degradation via saccharopine pathway; glutaryl-CoA from L-lysine: step 2/6.
  • Sequence similarities
    Belongs to the saccharopine dehydrogenase family.
  • Information by UniProt
  • Database links
  • Alternative names
    • CGI 49 antibody
    • CGI49 antibody
    • FLJ43187 antibody
    • Probable saccharopine dehydrogenase antibody
    • Saccharopine dehydrogenase antibody
    • SCCPDH antibody
    • SCPDH_HUMAN antibody
    see all

Images

  • Anti-SCCPDH antibody (ab81226) at 1 µg/ml (in 5% skim milk / PBS buffer) + fetal muscle lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 47 kDa
    Observed band size : 47 kDa
    Additional bands at : 31 kDa. We are unsure as to the identity of these extra bands.

References

ab81226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab81226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up