Overview

  • Product nameAnti-SCFD1 antibody
    See all SCFD1 primary antibodies
  • Description
    Rabbit polyclonal to SCFD1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region from N terminal amino acids 72-121 (

    AVTQVAKVFDQYLNFITLEDDMFVLCNQNKELVSYRAINRPDITDTEMET

    ) of Human SCFD1 (NP_878255).

  • Positive control
    • HepG2 cell lysate

Properties

Associated products

Applications

Our Abpromise guarantee covers the use of ab90043 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 65 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionPlays a role in SNARE-pin assembly and Golgi-to-ER retrograde transport via its interaction with COG4. Involved in vesicular transport between the endoplasmic reticulum and the Golgi.
  • Sequence similaritiesBelongs to the STXBP/unc-18/SEC1 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationCytoplasm. Endoplasmic reticulum membrane. Golgi apparatus > Golgi stack membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • C14orf163 antibody
    • Chromosome 14 open reading frame 163 antibody
    • RA410 antibody
    • Scfd1 antibody
    • SCFD1_HUMAN antibody
    • Sec1 family domain containing 1 antibody
    • Sec1 family domain-containing protein 1 antibody
    • SLY1 antibody
    • SLY1 homolog antibody
    • Sly1p antibody
    • STXBP1L2 antibody
    • Syntaxin binding protein 1 like 2 antibody
    • Syntaxin-binding protein 1-like 2 antibody
    • Vesicle transport related protein antibody
    see all

Anti-SCFD1 antibody images

  • Anti-SCFD1 antibody (ab90043) at 1 µg/ml (5% skim milk / PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 65 kDa

References for Anti-SCFD1 antibody (ab90043)

ab90043 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90043.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"