Overview

  • Product nameAnti-SCLT1 antibody
    See all SCLT1 primary antibodies
  • Description
    Rabbit polyclonal to SCLT1
  • Tested applicationsSuitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SCLT1 aa 144-222 (internal sequence).
    Sequence:

    KTQAVELWQTVSQELDRLHKLYQEHMTEAQIHVFESQKQKDQLFDFQQLT KQLHVTNENMEVTNQQFLKTVTEQSVIIE

  • Positive control
    • Human U-2 OS cells; Human duodenum tissue; Human tonsil, RT-4 and U-251 MG cell lysates.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferpH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100
WB 1/250 - 1/500.

Target

  • FunctionAdapter protein that links SCN10A to clathrin. Regulates SCN10A channel activity, possibly by promoting channel internalization.
  • Cellular localizationCytoplasm. Cell periphery.
  • Information by UniProt
  • Database links
  • Alternative names
    • CAP-1A antibody
    • CAP1A antibody
    • FLJ30655 antibody
    • hCAP-1A antibody
    • SAP1 antibody
    • SCLT1 antibody
    • SCLT1_HUMAN antibody
    • Sodium channel and clathrin linker 1 antibody
    • Sodium channel-associated protein 1 antibody
    see all

Anti-SCLT1 antibody images

  • All lanes : Anti-SCLT1 antibody (ab122347) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Developed using the ECL technique
  • ab122347, at a 1/45 dilution, staining SCLT1 in paraffin-embedded Human duodenum tissue by immunohistochemistry.
  • ab122347, at 4 µg/ml, staining SCLT1 (in green) in PFA-fixed, Triton-permeabilized Human U-2 OS cells by immunofluorescence.

References for Anti-SCLT1 antibody (ab122347)

ab122347 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab122347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"