Overview

  • Product name
  • Description
    Rabbit polyclonal to SCLT1
  • Tested applications
    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human SCLT1 aa 144-222 (internal sequence).
    Sequence:

    KTQAVELWQTVSQELDRLHKLYQEHMTEAQIHVFESQKQKDQLFDFQQLT KQLHVTNENMEVTNQQFLKTVTEQSVIIE

  • Positive control
    • Human U-2 OS cells; Human duodenum tissue; Human tonsil, RT-4 and U-251 MG cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab122347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100
WB 1/250 - 1/500.

Target

  • Function
    Adapter protein that links SCN10A to clathrin. Regulates SCN10A channel activity, possibly by promoting channel internalization.
  • Cellular localization
    Cytoplasm. Cell periphery.
  • Information by UniProt
  • Database links
  • Alternative names
    • CAP-1A antibody
    • CAP1A antibody
    • FLJ30655 antibody
    • hCAP-1A antibody
    • SAP1 antibody
    • SCLT1 antibody
    • SCLT1_HUMAN antibody
    • Sodium channel and clathrin linker 1 antibody
    • Sodium channel-associated protein 1 antibody
    see all

Images

  • All lanes : Anti-SCLT1 antibody (ab122347) at 1/250 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Developed using the ECL technique
  • ab122347, at a 1/45 dilution, staining SCLT1 in paraffin-embedded Human duodenum tissue by immunohistochemistry.
  • ab122347, at 4 µg/ml, staining SCLT1 (in green) in PFA-fixed, Triton-permeabilized Human U-2 OS cells by immunofluorescence.

References

ab122347 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab122347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up