Overview

  • Product name
    Anti-SCP3 antibody [6F9C5]
    See all SCP3 primary antibodies
  • Description
    Mouse monoclonal [6F9C5] to SCP3
  • Host species
    Mouse
  • Tested applications
    Suitable for: IHC-P, WB, ICC/IF, Flow Cytmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human SCP3 aa 27-128. Expressed in E. Coli.
    Sequence:

    FETEDKKDLSGSEEDVIEGKTAVIEKRRKKRSSAGVVEDMGGEVQNMLEG VGVDINKALLAKRKRLEMYTKASLKTSNQKIEHVWKTQQDQRQKLNQEYS QQ


    Database link: Q8IZU3

  • Positive control
    • SCP3 recombinant protein; SCP3 (aa 27-128)-hIgGFc transfected HEK293 cell lysate; HepG2 cells; Jurkat cells; Human cervical cancer and Human kidney tissues.
  • General notes

    This product was changed from ascites to supernatant. Lot no’s high than GR160891-17 are from Tissue Culture Supernatant

Properties

Applications

Our Abpromise guarantee covers the use of ab181746 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/1000.
WB 1/500 - 1/2000. Predicted molecular weight: 28 kDa.
ICC/IF 1/200 - 1/1000.
Flow Cyt 1/200 - 1/400.

ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody.

 

Target

  • Function
    Component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Has an essential meiotic function in spermatogenesis. May be important for testis development.
  • Tissue specificity
    Testis-specific.
  • Involvement in disease
    Defects in SYCP3 are a cause of azoospermia due to perturbations of meiosis (AZSPM) [MIM:270960]. AZSPM is a condition of having no sperm present in the ejaculate. Testicular histology shows arrest of spermatogenesis at the pachytene stage of primary spermatocytes.
  • Sequence similarities
    Belongs to the XLR/SYCP3 family.
  • Cellular localization
    Nucleus. In tripartite segments of synaptonemal complexes, irrespective of whether these are synapsed or unsynapsed.
  • Information by UniProt
  • Database links
  • Alternative names
    • choline phosphotransferase 1 antibody
    • chpt1 antibody
    • COR 1 antibody
    • COR1 antibody
    • MGC71888 antibody
    • RNASCP3 antibody
    • SCP 3 antibody
    • SCP-3 antibody
    • SCP3 antibody
    • SPGF4 antibody
    • Sycp 3 antibody
    • Sycp3 antibody
    • SYCP3_HUMAN antibody
    • Synaptonemal complex protein 3 antibody
    see all

Images

  • Immunofluorescent analysis of HepG2 cells labeling SPC3 with ab181746 at 1/200 (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.

  • Anti-SCP3 antibody [6F9C5] (ab181746) at 1/500 dilution + SCP3 recombinant protein

    Predicted band size: 28 kDa

  • All lanes : Anti-SCP3 antibody [6F9C5] (ab181746) at 1/500 dilution

    Lane 1 : non-transfected HEK293 cell lysate
    Lane 2 : SCP3 (aa 27-128)-hIgGFc transfected HEK293 cell lysate

    Predicted band size: 28 kDa

  • Flow Cytometrical analysis of Jurkat cells labeling SCP3 with ab181746 at 1/200 (green) compared to a negative control antibody (red).

  • Immunohistochemical analysis of paraffin embedded Human kidney tissue labeling SCP3 with ab181746 at 1/200.

  • Immunohistochemical analysis of paraffin embedded Human cervical cancer tissue labeling SCP3 with ab181746 at 1/200.

References

This product has been referenced in:
  • Yu X  et al. Human amniotic fluid stem cells possess the potential to differentiate into primordial follicle oocytes in vitro. Biol Reprod 90:73 (2014). Human . Read more (PubMed: 24571984) »

See 1 Publication for this product

Customer reviews and Q&As

The information "testis specific" and "Component of the transverse filaments of synaptonemal complexes (SCS), formed between homologous chromosomes during meiotic prophase. Has an essential meiotic function in spermatogenesis. May be imp...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up