Overview

  • Product nameAnti-SCUBE2 antibody
    See all SCUBE2 primary antibodies
  • Description
    Rabbit polyclonal to SCUBE2
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within C terminal amino acids 683-732 (KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCG G) of Human SCUBE2 (NP_066025)

  • Positive control
    • HeLa cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Associated products

Applications

Our Abpromise guarantee covers the use of ab82987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 90 kDa (predicted molecular weight: 110 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

  • Tissue specificityExpressed in a broad spectrum of adult tissues.
  • Sequence similaritiesContains 1 CUB domain.
    Contains 9 EGF-like domains.
  • Cellular localizationSecreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • 4932442O19Rik antibody
    • Cegb1 antibody
    • Cegf1 antibody
    • CEGP1 antibody
    • Cegp1 protein antibody
    • CUB domain and EGF-like repeat containing 1 antibody
    • FLJ16792 antibody
    • FLJ35234 antibody
    • ICRFP703B1614Q5.1 antibody
    • MGC133057 antibody
    • Protein CEGP1 antibody
    • RGD1563998 antibody
    • SCUB2_HUMAN antibody
    • Scube2 antibody
    • Signal peptide, CUB and EGF-like domain-containing protein 2 antibody
    • Signal peptide, CUB domain, EGF-like 2 antibody
    see all

Anti-SCUBE2 antibody images

  • Anti-SCUBE2 antibody (ab82987) at 1 µg/ml + HeLa cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 110 kDa
    Observed band size : 90 kDa (why is the actual band size different from the predicted?)

References for Anti-SCUBE2 antibody (ab82987)

ab82987 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82987.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"