Overview

  • Product name
    Anti-SDF1 antibody - C-terminal
    See all SDF1 primary antibodies
  • Description
    Rabbit polyclonal to SDF1 - C-terminal
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human SDF1 aa 63-92 (C terminal) conjugated to keyhole limpet haemocyanin. Synthetic peptide conjugated to KLH, corresponding to a region within C terminal amino acids 63-92 (LKNNNRQVCIDPKLKWIQEYLEKALNKRFK) of Human SDF1 (UniProt ID: P48061).
    Sequence:

    LKNNNRQV CIDPKLKWIQ EYLEKALNKR FK


    Database link: P48061

  • Positive control
    • WB: NCI-H292 cell line lysates.
      IHC: Human liver tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab168825 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/500. Predicted molecular weight: 10 kDa.
IHC-P 1/10 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation.
  • Tissue specificity
    Isoform Alpha and isoform Beta are ubiquitously expressed, with highest levels detected in liver, pancreas and spleen. Isoform Gamma is mainly expressed in heart, with weak expression detected in several other tissues. Isoform Delta, isoform Epsilon and isoform Theta have highest expression levels in pancreas, with lower levels detected in heart, kidney, liver and spleen.
  • Sequence similarities
    Belongs to the intercrine alpha (chemokine CxC) family.
  • Developmental stage
    Isoform Alpha is ubiquitously expressed in fetal tissues. Isoform Beta and isoform Delta have more limited expression patterns, with highest levels detected in fetal spleen and fetal liver, respectively. Isoform Gamma and isoform Theta are weakly detected in fetal kidney.
  • Post-translational
    modifications
    Processed forms SDF-1-beta(3-72) and SDF-1-alpha(3-67) are produced after secretion by proteolytic cleavage of isoforms Beta and Alpha, respectively. The N-terminal processing is probably achieved by DPP4. Isoform Alpha is first cleaved at the C-terminus to yield a SDF-1-alpha(1-67) intermediate before being processed at the N-terminus. The C-terminal processing of isoform Alpha is reduced by binding to heparin and, probably, cell surface proteoglycans.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • 12-O-tetradecanoylphorbol 13-acetate repressed protein 1 antibody
    • AI174028 antibody
    • C-X-C motif chemokine 12 antibody
    • Chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) antibody
    • Chemokine (C-X-C motif) ligand 12 antibody
    • Chemokine CXC motif ligand 12 antibody
    • cxcl12 antibody
    • hIRH antibody
    • hSDF-1 antibody
    • Intercrine reduced in hepatomas antibody
    • IRH antibody
    • OTTHUMP00000019491 antibody
    • PBSF antibody
    • Pre-B cell growth-stimulating factor antibody
    • SCYB12 antibody
    • SDF 1 antibody
    • SDF-1 antibody
    • SDF-1-alpha(3-67) antibody
    • SDF-1a antibody
    • SDF-1b antibody
    • SDF1_HUMAN antibody
    • SDF1A antibody
    • SDF1B antibody
    • Stromal cell-derived factor 1 antibody
    • Stromal cell-derived factor 1 delta antibody
    • Stromal cell-derived factor 1 gamma antibody
    • Stromal cell-derived factor 1a antibody
    • Stromal cell-derived factor-1 alpha antibody
    • Thymic lymphoma cell-stimulating factor antibody
    • Tlsf antibody
    • TLSF-a antibody
    • TLSF-b antibody
    • Tlsfa antibody
    • Tlsfb antibody
    • TPAR1 antibody
    see all

Images

  • Anti-SDF1 antibody - C-terminal (ab168825) at 1/100 dilution + NCI-H292 cell line lysates at 35 µg

    Predicted band size : 10 kDa
  • Immunohistochemistry analysis of formalin fixed and paraffin embedded Human liver tissue labeling SDF1 with ab168825 at 1/10.

References

ab168825 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168825.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up