Anti-Secretory lectin ZG16 antibody (ab185483)

Overview

  • Product name
    Anti-Secretory lectin ZG16 antibody
    See all Secretory lectin ZG16 primary antibodies
  • Description
    Rabbit polyclonal to Secretory lectin ZG16
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Secretory lectin ZG16 aa 22-92.
    Sequence:

    RSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQVRYGKV WSDYVGGRNGDLEEIFLHPGE


    Database link: O60844

  • Positive control
    • Human colon tissue.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab185483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function
    May play a role in protein trafficking. May act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.
  • Tissue specificity
    Highly expressed in liver. Detected at lower levels in colon, ileum and jejunum.
  • Sequence similarities
    Belongs to the jacalin lectin family.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix. Cytoplasmic vesicle lumen. Golgi apparatus lumen. Stored in zymogen granules.
  • Information by UniProt
  • Database links
  • Alternative names
    • hZG16 antibody
    • Jacalin like lectin domain containing antibody
    • JCLN antibody
    • JCLN1 antibody
    • Secretory lectin ZG16 antibody
    • Zg16 antibody
    • ZG16_HUMAN antibody
    • ZG16A antibody
    • Zymogen granule membrane protein 16 antibody
    • Zymogen granule protein 16 antibody
    • Zymogen granule protein 16 homolog antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling Secretory lectin ZG16 with ab185483 at 1/500 dilution.

References

ab185483 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up