Anti-Secretory lectin ZG16 antibody - Azide free (ab175629)

Overview

  • Product name
    Anti-Secretory lectin ZG16 antibody - Azide free
    See all Secretory lectin ZG16 primary antibodies
  • Description
    Sheep polyclonal to Secretory lectin ZG16 - Azide free
  • Host species
    Sheep
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Human Secretory lectin ZG16 aa 17-167. (10aa N-Terminal His-tag. Produced in E.coli).
    Sequence:

    NAIQARSSSYSGEYGSGGGKRFSHSGNQLDGPITALRVRVNTYYIVGLQV RYGKVWSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGR YLSFGKDSGTSFNAVPLHPNTVLRFISGRSGSLIDAIGLHWDVYPTSCSR C


    Database link: O60844

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Constituents: 0.58% Sodium chloride, 99% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG

Applications

Our Abpromise guarantee covers the use of ab175629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 18 kDa.

Target

  • Function
    May play a role in protein trafficking. May act as a linker molecule between the submembranous matrix on the luminal side of zymogen granule membrane (ZGM) and aggregated secretory proteins during granule formation in the TGN.
  • Tissue specificity
    Highly expressed in liver. Detected at lower levels in colon, ileum and jejunum.
  • Sequence similarities
    Belongs to the jacalin lectin family.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix. Cytoplasmic vesicle lumen. Golgi apparatus lumen. Stored in zymogen granules.
  • Information by UniProt
  • Database links
  • Alternative names
    • hZG16 antibody
    • Jacalin like lectin domain containing antibody
    • JCLN antibody
    • JCLN1 antibody
    • Secretory lectin ZG16 antibody
    • Zg16 antibody
    • ZG16_HUMAN antibody
    • ZG16A antibody
    • Zymogen granule membrane protein 16 antibody
    • Zymogen granule protein 16 antibody
    • Zymogen granule protein 16 homolog antibody
    see all

References

ab175629 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up