Anti-Secretory phospholipase A2 Type V antibody (ab97847)

Overview

  • Product nameAnti-Secretory phospholipase A2 Type V antibody
    See all Secretory phospholipase A2 Type V primary antibodies
  • Description
    Rabbit polyclonal to Secretory phospholipase A2 Type V
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1 - 50 (

    MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW

    ) of Human Secretory phospholipase A2 Type V (NP_000920).

  • Positive control
    • Fetal thymus lysate

Applications

Our Abpromise guarantee covers the use of ab97847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionPA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle.
  • Tissue specificityHeart, placenta and less abundantly, in lung.
  • Sequence similaritiesBelongs to the phospholipase A2 family.
  • Post-translational
    modifications
    This enzyme lacks one of the seven disulfide bonds found in similar PA2 proteins.
  • Cellular localizationSecreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Ca2+ dependent phospholipase A2 antibody
    • Calcium dependent phospholipase A2 antibody
    • Calcium-dependent phospholipase A2 antibody
    • DKFZp686C2294 antibody
    • FRFB antibody
    • Group V phospholipase A2 antibody
    • GV PLA2 antibody
    • gVPLA2 antibody
    • hVPLA(2) antibody
    • MGC46205 antibody
    • OTTHUMP00000044655 antibody
    • PA2G5_HUMAN antibody
    • Phosphatidylcholine 2 acylhydrolase antibody
    • Phosphatidylcholine 2-acylhydrolase 5 antibody
    • Phospholipase A2 group V antibody
    • PLA2 10 antibody
    • PLA2 G5 antibody
    • PLA2-10 antibody
    • Pla2g5 antibody
    • sPLA2 Type V antibody
    see all

Anti-Secretory phospholipase A2 Type V antibody images

  • Anti-Secretory phospholipase A2 Type V antibody (ab97847) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal thymus cell lysate at 10 µg

    Secondary
    HRP-conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 14 kDa

References for Anti-Secretory phospholipase A2 Type V antibody (ab97847)

ab97847 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab97847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"