Anti-Secretory phospholipase A2 Type V antibody (ab97847)

Overview

  • Product name
    Anti-Secretory phospholipase A2 Type V antibody
    See all Secretory phospholipase A2 Type V primary antibodies
  • Description
    Rabbit polyclonal to Secretory phospholipase A2 Type V
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1 - 50 (

    MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW

    ) of Human Secretory phospholipase A2 Type V (NP_000920).

  • Positive control
    • Fetal thymus lysate

Applications

Our Abpromise guarantee covers the use of ab97847 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 14 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle.
  • Tissue specificity
    Heart, placenta and less abundantly, in lung.
  • Sequence similarities
    Belongs to the phospholipase A2 family.
  • Post-translational
    modifications
    This enzyme lacks one of the seven disulfide bonds found in similar PA2 proteins.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Ca2+ dependent phospholipase A2 antibody
    • Calcium dependent phospholipase A2 antibody
    • Calcium-dependent phospholipase A2 antibody
    • DKFZp686C2294 antibody
    • FRFB antibody
    • Group V phospholipase A2 antibody
    • GV PLA2 antibody
    • gVPLA2 antibody
    • hVPLA(2) antibody
    • MGC46205 antibody
    • OTTHUMP00000044655 antibody
    • PA2G5_HUMAN antibody
    • Phosphatidylcholine 2 acylhydrolase antibody
    • Phosphatidylcholine 2-acylhydrolase 5 antibody
    • Phospholipase A2 group V antibody
    • PLA2 10 antibody
    • PLA2 G5 antibody
    • PLA2-10 antibody
    • Pla2g5 antibody
    • sPLA2 Type V antibody
    see all

Images

  • Anti-Secretory phospholipase A2 Type V antibody (ab97847) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal thymus cell lysate at 10 µg

    Secondary
    HRP-conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 14 kDa



    Gel concentration: 10-20%

References

ab97847 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab97847.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up