Overview

  • Product name
  • Description
    Rabbit polyclonal to Securin 2
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rabbit, Horse, Cow, Cat, Dog, Pig, Chimpanzee
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 73-122 (SVKTNGPRKQKQPSFSAKKMTEKTVKTKSSVPASDDAYPEIEKFFPFNL L) of Human Securin 2, NP_006598

  • Positive control
    • HepG2 cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab81181 is purified by a peptide affinity chromatography method.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab81181 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Detects a band of approximately 21 kDa (predicted molecular weight: 21 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/312500.

Target

  • Tissue specificity
    Expressed at low levels in the pituitary, liver, spleen, prostate, testis, ovary, small intestine and colon. Also expressed in various pituitary, testicular, liver and ovarian tumors.
  • Sequence similarities
    Belongs to the securin family.
  • Domain
    The N-terminal destruction box (D-box) acts as a recognition signal for degradation via the ubiquitin-proteasome pathway.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Pituitary tumor transforming 2 antibody
    • Pituitary tumor transforming gene 2 protein antibody
    • Pituitary tumor-transforming gene 2 protein antibody
    • PTTG2 antibody
    • PTTG2_HUMAN antibody
    • Securin-2 antibody
    see all

Anti-Securin 2 antibody images

  • Anti-Securin 2 antibody (ab81181) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 21 kDa
    Observed band size : 26 kDa (why is the actual band size different from the predicted?)

References for Anti-Securin 2 antibody (ab81181)

ab81181 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab81181.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up