Overview

  • Product name
  • Description
    Rabbit polyclonal to SEMA6D
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Guinea pig, Cow, Dog, Pig, Chimpanzee, Chinese hamster
  • Immunogen

    Synthetic peptide within Human SEMA6D aa 1023-1073 (C terminal). The exact sequence is proprietary. NP_705871.1.
    Sequence:

    PSLSRQSSYTSNGTLPRTGLKRTPSLKPDVPPKPSFVPQTPSVRPLNKYT Y


    Database link: Q8NFY4

  • Positive control
    • HeLa cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab191169 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 120 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • Detection of SEMA6D in Immunoprecipitates of HeLa whole cell lysates (1 mg for IP, 20% of IP loaded) using ab191169 at 6 µg/reaction for IP and 1µg/ml for WB detection (Lane 1). Lane 2 represents control IgG IP. Detection: Chemiluminescence with an exposure time of 3 minutes.

  • Anti-SEMA6D antibody (ab191169) at 0.4 µg/ml + HeLa whole cell lysate (in NETN lysis buffer) at 50 µg
    Developed using the ECL technique

    Predicted band size : 120 kDa


    Exposure time : 3 minutes

References

ab191169 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191169.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up