Overview

  • Product name
    Anti-Semenogelin II antibody
  • Description
    Rabbit polyclonal to Semenogelin II
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Pig, African green monkey
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 42-91 (

    GQKGQHYFGQKDQQHTKSKGSFSIQHTYHVDINDHDWTRKSQQYDLNALH

    ) of human Semenogelin II (NP_002999)

  • Positive control
    • COLO205 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab108085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 65 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Participates in the formation of a gel matrix (sperm coagulum) entrapping the accessory gland secretions and ejaculated spermatozoa.
  • Tissue specificity
    Seminal vesicles, and to a much lesser extent, epididymis.
  • Sequence similarities
    Belongs to the semenogelin family.
  • Post-translational
    modifications
    Semenogelin-2 is thought to form both the 71 kDa polypeptide and, in its glycosylated form, the 76 kDa polypeptide.
  • Cellular localization
    Secreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Semenogelin 2 antibody
    • Semenogelin II antibody
    • Semenogelin-2 antibody
    • SEMG2 antibody
    • SEMG2_HUMAN antibody
    • SGII antibody
    see all

Images

  • Anti-Semenogelin II antibody (ab108085) at 1 µg/ml + COLO205 cell lysate at 10 µg

    Predicted band size: 65 kDa



    Gel concentration: 12%

References

ab108085 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up