Overview

  • Product nameAnti-Semenogelin II antibody
    See all Semenogelin II primary antibodies
  • Description
    Rabbit polyclonal to Semenogelin II
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Pig, African Green Monkey
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 42-91 (

    GQKGQHYFGQKDQQHTKSKGSFSIQHTYHVDINDHDWTRKSQQYDLNALH

    ) of human Semenogelin II (NP_002999)

  • Positive control
    • COLO205 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab108085 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 65 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionParticipates in the formation of a gel matrix (sperm coagulum) entrapping the accessory gland secretions and ejaculated spermatozoa.
  • Tissue specificitySeminal vesicles, and to a much lesser extent, epididymis.
  • Sequence similaritiesBelongs to the semenogelin family.
  • Post-translational
    modifications
    Semenogelin-2 is thought to form both the 71 kDa polypeptide and, in its glycosylated form, the 76 kDa polypeptide.
  • Cellular localizationSecreted.
  • Information by UniProt
  • Database links
  • Alternative names
    • Semenogelin 2 antibody
    • Semenogelin II antibody
    • Semenogelin-2 antibody
    • SEMG2 antibody
    • SEMG2_HUMAN antibody
    • SGII antibody
    see all

Anti-Semenogelin II antibody images

  • Anti-Semenogelin II antibody (ab108085) at 1 µg/ml + COLO205 cell lysate at 10 µg

    Predicted band size : 65 kDa

References for Anti-Semenogelin II antibody (ab108085)

ab108085 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108085.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"