Overview

  • Product name
  • Description
    Rabbit polyclonal to SENP5
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Does not react with: Rat
  • Immunogen

    Recombinant fragment corresponding to Human SENP5 aa 360-755.
    Sequence:

    SCSSPKWECTELIHDIPLPEHRSNTMFISETEREIMTLGQENQTSSVSDD RVKLSVSGADTSVSSVDGPVSQKAVQNENSYQMEEDGSLKQSILSSELLD HPYCKSPLEAPLVCSGLKLENQVGGGKNSQKASPVDDEQLSVCLSGFLDE VMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKPFINREITNYRARHQKCN FRIFYNKHMLDMDDLATLDGQNWLNDQVINMYGELIMDAVPDKVHFFNSF FHRQLVTKGYNGVKRWTKKVDLFKKSLLLIPIHLEVHWSLITVTLSNRII SFYDSQGIHFKFCVENIRKYLLTEAREKNRPEFLQGWQTAVTKCIPQQKN DSDCGVFVLQYCKCLALEQPFQFSQEDMPRVRKRIYKELCECRLMD


    Database link: Q96HI0

  • Positive control
    • NIH 3T3 cell lysates; U2OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab183477 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 87 kDa.
ICC/IF 1/1000.

Target

  • Function
    Protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO3 to its mature form and deconjugation of SUMO2 and SUMO3 from targeted proteins. Has weak proteolytic activity against full-length SUMO1 or SUMO1 conjugates. Required for cell division.
  • Sequence similarities
    Belongs to the peptidase C48 family.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt
  • Database links
  • Alternative names
    • FKSG45 antibody
    • FLJ42398 antibody
    • MGC27076 antibody
    • Protease FKSG45 antibody
    • SENP5 antibody
    • SENP5_HUMAN antibody
    • Sentrin specific protease SENP5 antibody
    • Sentrin-specific protease 5 antibody
    • Sentrin/SUMO specific protease SENP5 antibody
    • Sentrin/SUMO-specific protease SENP5 antibody
    • SUMO specific protease SENP5 antibody
    • SUMO1/sentrin specific peptidase 5 antibody
    • SUMO1/sentrin specific protease 5 antibody
    see all

Images

  • All lanes : Anti-SENP5 antibody (ab183477) at 1/2000 dilution

    Lane 1 : U2OS cells transfected with control si RNA
    Lane 2 : U2OS cells transfected with SENP5 si RNA
    Lane 3 : Rat INS1 lysate
    Lane 4 : Mouse NIH 3T3 lysate

    Lysates/proteins at 40 µg per lane.


    Predicted band size : 87 kDa
  • Immunofluorescent analysis of Control siRNA and SENP5 siRNA transfected cells (U2OS) labeling SENP5 with ab183477 at 1/1000 dilution (top panels). Cells are counter stained with DAPI (blue) and merged in lower images.

References

ab183477 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (HeLa)
Permeabilization
Yes - 0.5% Triton 5 minutes
Specification
HeLa
Blocking step
Serum as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 25°C
Fixative
Paraformaldehyde
Username

Abcam user community

Verified customer

Submitted Oct 20 2017

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up