Overview

  • Product nameAnti-SEP15 antibody
    See all SEP15 primary antibodies
  • Description
    Rabbit polyclonal to SEP15
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    A synthetic peptide within residues

    VRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEF

    corresponding to amino acids 109-158 of Human SEP15 (NP_004252)

  • Positive control
    • HepG2 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab80985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 15 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-SEP15 antibody images

  • Anti-SEP15 antibody (ab80985) at 1 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 15 kDa
    Observed band size : 24 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 33 kDa. We are unsure as to the identity of these extra bands.

References for Anti-SEP15 antibody (ab80985)

This product has been referenced in:
  • Miniard AC  et al. Nucleolin binds to a subset of selenoprotein mRNAs and regulates their expression. Nucleic Acids Res 38:4807-20 (2010). Read more (PubMed: 20385601) »

See 1 Publication for this product

Product Wall

Abcam has not validated the combination of species/application used in this Abreview.
Application Western blot
Sample Mouse Cell lysate - whole cell (primary B cells, 3T3 cells)
Loading amount 40 µg
Specification primary B cells, 3T3 cells
Gel Running Conditions Reduced Denaturing (Gradient gel)
Blocking step Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Feb 10 2012

Thank you for contacting us.

We have not validated this antibody for use on mouse, and therefore do not batch test it on mouse samples. If you would like to test the recent batch on a positive control from human samples, we would be happy to...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"