Overview

  • Product nameAnti-SERPINB1 antibody
    See all SERPINB1 primary antibodies
  • Description
    Rabbit polyclonal to SERPINB1
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Horse, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within internal amino acids 215-264 (

    RVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENL

    ) of Human SERPINB1 (NP_109591).

  • Positive control
    • Human Fetal Stomach lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab99124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionRegulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3.
  • Sequence similaritiesBelongs to the serpin family. Ov-serpin subfamily.
  • DomainReactive bond 1 is specific for reaction with chymotrypsin-like protease such as cathepsin G, chymotrypsin or chymase, while reactive bond 2 is specific for reaction with elastase-like protease such as neutrophyl elastase, proteinase-3, pancreatic elastase or PSA.
  • Cellular localizationCytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • Anti elastase antibody
    • EI antibody
    • ELANH2 antibody
    • Epididymis luminal protein 57 antibody
    • HEL57 antibody
    • ILEU_HUMAN antibody
    • LEI antibody
    • Leukocyte elastase inhibitor antibody
    • M/NEI antibody
    • MNEI antibody
    • Monocyte/neutrophil elastase inhibitor antibody
    • Peptidase inhibitor 2 antibody
    • Pi-2 antibody
    • PI2 antibody
    • Serine (or cysteine) proteinase inhibitor clade B (ovalbumin) member 1 antibody
    • Serpin B1 antibody
    • Serpin peptidase inhibitor clade B (ovalbumin) member 1 antibody
    • serpinb1 antibody
    see all

Anti-SERPINB1 antibody images

  • Anti-SERPINB1 antibody (ab99124) at 1 µg/ml + Human Fetal Stomach Lysate at 10 µg

    Predicted band size : 43 kDa

References for Anti-SERPINB1 antibody (ab99124)

ab99124 has not yet been referenced specifically in any publications.

Product Wall

Application Western blot
Sample Mouse Tissue lysate - other (cellular fractionation of hindpaw skin protein)
Gel Running Conditions Reduced Denaturing
Loading amount 50 µg
Specification cellular fractionation of hindpaw skin protein
Blocking step LiCOR blocking buffer as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 50% · Temperature: 24°C
Username

Abcam user community

Verified customer

Submitted Sep 16 2015

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"