Overview

  • Product name
  • Description
    Rabbit polyclonal to SETD3
  • Tested applications
    Suitable for: WB, IPmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Cow, Dog, Pig, Zebrafish, Rhesus monkey, Xenopus tropicalis
  • Immunogen

    Synthetic peptide within Human SETD3 aa 1-50 (N terminal). The exact sequence is proprietary.
    Sequence:

    MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEY


    Database link: Q86TU7

  • Positive control
    • Jurkat, HeLa, 293T, mouse TCMK1 and mouse NIH 3T3 whole cell lysates.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Purification notes
    ab176582 was affinity purified using an epitope specific to SETD3 immobilized on solid support.
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab176582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 67 kDa.
IP Use at 2-10 µg/mg of lysate.

Target

Images

  • Detection of SETD3 by Western Blot of Immunprecipitate.
    Anti-SETD3 antibody at 1µg/ml labeling SETD3 in Jurkat whole cell lysate (1 mg/IP; 20% of IP loaded) immunoprecipitated using ab176582 at 6µg/mg lysate.

    Detection: Chemiluminescence with exposure time of 30 seconds.

  • All lanes : Anti-SETD3 antibody (ab176582) at 0.1 µg/ml

    Lane 1 : Jurkat whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : 293T whole cell lysate
    Lane 4 : Mouse TCMK1 whole cell lysate
    Lane 5 : Mouse NIH3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique

    Predicted band size : 67 kDa


    Exposure time : 1 minute

References

This product has been referenced in:

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176582.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up