Overview

  • Product name
    Anti-SF3B4 antibody [3A1]
    See all SF3B4 primary antibodies
  • Description
    Mouse monoclonal [3A1] to SF3B4
  • Host species
    Mouse
  • Tested applications
    Suitable for: WB, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Cow, Human
  • Immunogen

    Recombinant full length protein corresponding to Human SF3B4 aa 1-424. Expressed in and purified from E. Coli.
    Sequence:

    MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVT GQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGA NIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFA SFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNP LSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPP GALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGG MPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMG MPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGP LPPPRPTPRPPVPPRGPLRGPLPQ


    Database link: Q15427

  • Positive control
    • HeLa cells and cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab183483 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 44 kDa.
ICC/IF 1/1000.

Target

Images

  • Immunofluorescent analysis of HeLa cells labeling SF3B4 with ab183483 at 1/1000 dilution (red). Vimentin is labeled in green.

  • Anti-SF3B4 antibody [3A1] (ab183483) at 1/2000 dilution + HeLa lysate

    Predicted band size: 44 kDa

References

ab183483 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab183483.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up