Anti-SFRS7/SRSF7 antibody (ab137247)
Key features and details
- Rabbit polyclonal to SFRS7/SRSF7
- Suitable for: IHC-P, IP
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-SFRS7/SRSF7 antibody
See all SFRS7/SRSF7 primary antibodies -
Description
Rabbit polyclonal to SFRS7/SRSF7 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, IPmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Turkey, Pig, Chimpanzee, Rhesus monkey, Gorilla, Orangutan, Platypus -
Immunogen
Synthetic peptide corresponding to Human SFRS7/SRSF7 aa 75-125.
Sequence:SRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSR R
Database link: NP_001026854.1 -
Positive control
- HeLa whole cell lysate (ab150035)
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7
Preservative: 0.09% Sodium azide
Constituent: 99% Tris citrate/phosphate
pH 7 to 8 -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab137247 was affinity purified using an epitope specific to SRSF7/SRSF7 immobilized on solid support -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab137247 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/1000 - 1/5000. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
|
|
IP |
Use at 2-10 µg/mg of lysate.
|
Notes |
---|
IHC-P
1/1000 - 1/5000. Perform heat mediated antigen retrieval before commencing with IHC staining protocol. |
IP
Use at 2-10 µg/mg of lysate. |
Target
-
Function
Required for pre-mRNA splicing. Can also modulate alternative splicing in vitro. Represses the splicing of MAPT/Tau exon 10. -
Tissue specificity
Brain, liver, kidney and lung. -
Sequence similarities
Belongs to the splicing factor SR family.
Contains 1 CCHC-type zinc finger.
Contains 1 RRM (RNA recognition motif) domain. -
Post-translational
modificationsExtensively phosphorylated on serine residues in the RS domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 6432 Human
- Entrez Gene: 225027 Mouse
- Entrez Gene: 362687 Rat
- Omim: 600572 Human
- SwissProt: Q3T106 Cow
- SwissProt: Q16629 Human
- SwissProt: Q8BL97 Mouse
- Unigene: 309090 Human
see all -
Alternative names
- 9G8 antibody
- AAG3 antibody
- arginine/serine-rich 7 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human colon carcinoma (left) and mouse renal cell carcinoma (right) tissues labelling SRSF7/SRSF7 with ab137247 at 1/5000 (0.2µg/ml) and 1/1000 (1µg/ml) . Detection: DAB.
-
Immunoprecipitation with ab137247 at 6µg/mg lysate. 1 mg of HeLa whole cell lysate used for IP (20% of IP loaded). Subsequent WB detection used an anti-SFRS7/SRSF7 antibody which recognizes a downstream epitope at 1 µg/ml. Detected by chemiluminescence with exposure time of 30 seconds.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab137247 has been referenced in 2 publications.
- Dahal S et al. The Thiazole-5-Carboxamide GPS491 Inhibits HIV-1, Adenovirus, and Coronavirus Replication by Altering RNA Processing/Accumulation. Viruses 14:N/A (2021). PubMed: 35062264
- Wong RW et al. An activator of G protein-coupled receptor and MEK1/2-ERK1/2 signaling inhibits HIV-1 replication by altering viral RNA processing. PLoS Pathog 16:e1008307 (2020). PubMed: 32069328