Overview

  • Product name
  • Description
    Rabbit polyclonal to SFRS9
  • Tested applications
    Suitable for: IP, ELISA, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Caenorhabditis elegans, Drosophila melanogaster, Zebrafish
  • Immunogen

    A synthetic peptide corresponding to a region of Human SFRS9

  • Positive control
    • Placenta cell lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab74782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/12500.

WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Plays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10.
  • Tissue specificity
    Expressed at high levels in the heart, kidney, pancreas and placenta, and at lower levels in the brain, liver, lung and skeletal muscle.
  • Sequence similarities
    Belongs to the splicing factor SR family.
    Contains 2 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Extensively phosphorylated on serine residues in the RS domain.
  • Cellular localization
    Nucleus. Cellular stresses such as heat shock may induce localization to discrete nuclear bodies termed SAM68 nuclear bodies (SNBs), HAP bodies, or stress bodies. Numerous splicing factors including SRSF1/SFRS1/SF2, SRSF7/SFRS7, SAFB and KHDRBS1/SAM68 accumulate at these structures, which may participate in the post-transcriptional regulation of mRNAs in stressed cells.
  • Information by UniProt
  • Database links
  • Alternative names
    • arginine/serine-rich 9 antibody
    • Pre mRNA splicing factor SRp30C antibody
    • Pre-mRNA-splicing factor SRp30C antibody
    • Serine/arginine-rich splicing factor 9 antibody
    • SFRS 9 antibody
    • Splicing factor antibody
    • Splicing factor arginine/serine rich 9 antibody
    • splicing factor, arginine/serine-rich 9 antibody
    • splicing factor, arginine/serine-rich, 30-KD, C antibody
    • SR splicing factor 9 antibody
    • SRP30C antibody
    • SRSF9 antibody
    • SRSF9_HUMAN antibody
    see all

Images

  • Anti-SFRS9 antibody (ab74782) at 1 µg/ml (in 5% skim milk / PBS buffer) + Placenta cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 26 kDa
    Observed band size : 24 kDa (why is the actual band size different from the predicted?)

References

This product has been referenced in:
  • Li SJ  et al. Splicing factor transformer-2ß (Tra2ß) regulates the expression of regulator of G protein signaling 4 (RGS4) gene and is induced by morphine. PLoS One 8:e72220 (2013). WB ; Rat . Read more (PubMed: 23977258) »

See 1 Publication for this product

Customer reviews and Q&As



SFRS9 antibody is a mid terminal with the region being 145-194. The 50 amino acid string in which the peptide is embedded:
GVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRS



Unfortunately, I couldn't find the proteins, ...

Read More

Thank you very much for getting back to us. We have now published the Abreviews.

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunoprecipitation
Sample
Mouse Cell lysate - whole cell (Isolated Cardiomyocytes)
Total protein in input
30 µg
Specification
Isolated Cardiomyocytes
Immuno-precipitation step
Other - Protein G coated Dynabeads
Username

Dr. Dinghai Zheng

Verified customer

Submitted Oct 05 2011

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Western blot
Sample
Mouse Cell lysate - whole cell (NSC34 cell line)
Loading amount
20 µg
Specification
NSC34 cell line
Gel Running Conditions
Reduced Denaturing (4-12% Bis-Tris nupage gel)
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Aug 03 2010

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up