Overview

  • Product nameAnti-SFRS9 antibody
    See all SFRS9 primary antibodies
  • Description
    Rabbit polyclonal to SFRS9
  • Tested applicationsSuitable for: IP, ELISA, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Caenorhabditis elegans, Drosophila melanogaster, Zebrafish
  • Immunogen

    A synthetic peptide corresponding to a region of Human SFRS9

  • Positive control
    • Placenta cell lysate.

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • ClonalityPolyclonal
  • IsotypeIgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab74782 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IP Use at an assay dependent concentration.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/12500.

WB Use a concentration of 1 µg/ml. Predicted molecular weight: 26 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionPlays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10.
  • Tissue specificityExpressed at high levels in the heart, kidney, pancreas and placenta, and at lower levels in the brain, liver, lung and skeletal muscle.
  • Sequence similaritiesBelongs to the splicing factor SR family.
    Contains 2 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications
    Extensively phosphorylated on serine residues in the RS domain.
  • Cellular localizationNucleus. Cellular stresses such as heat shock may induce localization to discrete nuclear bodies termed SAM68 nuclear bodies (SNBs), HAP bodies, or stress bodies. Numerous splicing factors including SRSF1/SFRS1/SF2, SRSF7/SFRS7, SAFB and KHDRBS1/SAM68 accumulate at these structures, which may participate in the post-transcriptional regulation of mRNAs in stressed cells.
  • Information by UniProt
  • Database links
  • Alternative names
    • arginine/serine-rich 9 antibody
    • Pre mRNA splicing factor SRp30C antibody
    • Pre-mRNA-splicing factor SRp30C antibody
    • Serine/arginine-rich splicing factor 9 antibody
    • SFRS 9 antibody
    • Splicing factor antibody
    • Splicing factor arginine/serine rich 9 antibody
    • splicing factor, arginine/serine-rich 9 antibody
    • splicing factor, arginine/serine-rich, 30-KD, C antibody
    • SR splicing factor 9 antibody
    • SRP30C antibody
    • SRSF9 antibody
    • SRSF9_HUMAN antibody
    see all

Anti-SFRS9 antibody images

  • Anti-SFRS9 antibody (ab74782) at 1 µg/ml (in 5% skim milk / PBS buffer) + Placenta cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 26 kDa
    Observed band size : 24 kDa (why is the actual band size different from the predicted?)

References for Anti-SFRS9 antibody (ab74782)

This product has been referenced in:
  • Li SJ  et al. Splicing factor transformer-2ß (Tra2ß) regulates the expression of regulator of G protein signaling 4 (RGS4) gene and is induced by morphine. PLoS One 8:e72220 (2013). WB ; Rat . Read more (PubMed: 23977258) »

See 1 Publication for this product

Product Wall



SFRS9 antibody is a mid terminal with the region being 145-194. The 50 amino acid string in which the peptide is embedded:
GVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRS



Unfortunately, I couldn't find the proteins, ...

Read More

Thank you very much for getting back to us. We have now published the Abreviews.

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Immunoprecipitation
Sample Mouse Cell lysate - whole cell (Isolated Cardiomyocytes)
Total protein in input 30 µg
Specification Isolated Cardiomyocytes
Immuno-precipitation step Other - Protein G coated Dynabeads
Username

Dr. Dinghai Zheng

Verified customer

Submitted Oct 05 2011

Abcam guarantees this product to work in the species/application used in this Abreview.
Application Western blot
Sample Mouse Cell lysate - whole cell (NSC34 cell line)
Loading amount 20 µg
Specification NSC34 cell line
Gel Running Conditions Reduced Denaturing (4-12% Bis-Tris nupage gel)
Blocking step BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
Username

Abcam user community

Verified customer

Submitted Aug 03 2010

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"