
  • Product name
  • Description
    Rabbit polyclonal to SGCE
  • Host species
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Mouse, Human
    Predicted to work with: Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 36-85 (TVYSIFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEISNDP I) of human SGCE (NP_001092871).

  • Positive control
    • 721_B cell lysate



Our Abpromise guarantee covers the use of ab84660 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 µg/ml.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • Function
    Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.
  • Tissue specificity
  • Involvement in disease
    Defects in SGCE are a cause of dystonia type 11 (DYT11) [MIM:159900]; also known as myoclonic dystonia or alcohol-responsive dystonia. DYT11 is a myoclonic dystonia. Dystonia is defined by the presence of sustained involuntary muscle contractions, often leading to abnormal postures. DYT11 is characterized by involuntary lightning jerks and dystonic movements and postures alleviated by alcohol. Inheritance is autosomal dominant. The age of onset, pattern of body involvement, presence of myoclonus and response to alcohol are all variable.
  • Sequence similarities
    Belongs to the sarcoglycan alpha/epsilon family.
  • Cellular localization
    Cell membrane > sarcolemma. Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links
  • Alternative names
    • dystonia 11, myoclonic antibody
    • DYT11 antibody
    • Epsilon sarcoglycan antibody
    • Epsilon SG antibody
    • Epsilon-sarcoglycan antibody
    • Epsilon-SG antibody
    • ESG antibody
    • sarcoglycan, epsilon antibody
    • sgcE antibody
    • SGCE_HUMAN antibody
    see all


  • Immunohistochemistry with pFA fixed Human skeletal muscle tissue at an antibody concentration of 5.0ug/ml using anti-SGCE antibody (ab84660)
  • ab84660 at a 1/500 dilution staining SGCE in Mouse cerebellum tissue by Immunohistochemistry.

  • Anti-SGCE antibody (ab84660) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size: 50 kDa
    Observed band size: 50 kDa


ab84660 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab84660.
Please use the links above to contact us or submit feedback about this product.


Sign up