Overview

  • Product nameAnti-SGEF antibody
    See all SGEF primary antibodies
  • Description
    Rabbit polyclonal to SGEF
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Cow, Cat, Pig, Saccharomyces cerevisiae
  • Immunogen

    Synthetic peptide corresponding to a region within N terminal amino acids 1-50 (MDGESEVDFSSNSITPLWRRRSIPQPHQVLGRSKPRPQSYQSPNGLLIT D) of Human SGEF (NP_056410).

  • Positive control
    • OVCAR-3 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab98848 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 97 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionActivates RhoG GTPase by promoting the exchange of GDP by GTP. Required for the formation of membrane ruffles during macropinocytosis. Required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, activated by SopB, which induces cytoskeleton rearrangements and promotes bacterial entry.
  • Tissue specificityIsoform 1 is broadly expressed, with highest levels in liver (at protein level). Certain mRNA species appear to be specifically expressed in prostate and liver.
  • Sequence similaritiesContains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
    Contains 1 SH3 domain.
  • Cellular localizationCell projection, ruffle.
  • Information by UniProt
  • Database links
  • Alternative names
    • ARHGEF26 antibody
    • ARHGEF26 Rho guanine nucleotide exchange factor (GEF) 26 antibody
    • ARHGQ_HUMAN antibody
    • CSGEF antibody
    • DKFZp434D146 antibody
    • HMFN1864 antibody
    • Rho guanine nucleotide exchange factor 26 antibody
    • SH3 domain-containing guanine exchange factor antibody
    see all

Anti-SGEF antibody images

  • Anti-SGEF antibody (ab98848) at 1 µg/ml + OVCAR-3 cell lysate at 10 µg

    Predicted band size : 97 kDa

References for Anti-SGEF antibody (ab98848)

ab98848 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98848.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"