
  • Product name
    Anti-SGK196 antibody
  • Description
    Rabbit polyclonal to SGK196
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within N terminal amino acids 72-121 (LSCEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSQLTSLEMKDDFL H) of Human SGK196, NP_115613

  • Positive control
    • 721_B cell lysate


  • Form
  • Storage instructions
    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer
    Preservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
  • Isotype
  • Research areas


Our Abpromise guarantee covers the use of ab81537 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 40 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1:312500.


  • Function
    Protein O-mannose kinase that specifically mediates phosphorylation at the 6-position of an O-mannose of the trisaccharide (N-acetylgalactosamine (GalNAc)-beta-1,3-N-acetylglucosamine (GlcNAc)-beta-1,4-mannose) to generate phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-1,3-N-acetylglucosamine-beta-1,4-(phosphate-6-)mannose). Phosphorylated O-mannosyl trisaccharide is a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity. Only shows kinase activity when the GalNAc-beta-3-GlcNAc-beta-terminus is linked to the 4-position of O-mannose, suggesting that this disaccharide serves as the substrate recognition motif.
  • Involvement in disease
    Muscular dystrophy-dystroglycanopathy congenital with brain and eye anomalies A12
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. STKL subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • FLJ23356 antibody
    • MDDGA12 antibody
    • POMK antibody
    • Probable inactive protein kinase-like protein SgK196 antibody
    • Protein kinase like protein SgK196 antibody
    • Protein kinase-like protein SgK196 antibody
    • Protein O-mannose kinase antibody
    • SG196_HUMAN antibody
    • SGK196 antibody
    • Sugen kinase 196 antibody
    see all

Anti-SGK196 antibody images

  • Anti-SGK196 antibody (ab81537) at 1 µg/ml (in 5% skim milk / PBS buffer) + 721_B cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 40 kDa
    Observed band size : 35 kDa (why is the actual band size different from the predicted?)

References for Anti-SGK196 antibody (ab81537)

ab81537 has not yet been referenced specifically in any publications.

Product Wall

Thank you for taking time to contact us. I am sorry to hear this antibody is not providing satisfactory results.

The details provided will enable us to investigate this case and will provide us with vital information for monitoring product q...

Read More


Sign up