Overview

  • Product name
  • Description
    Rabbit polyclonal to SHB
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken, Cow, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within the N terminal amino acids 1-50,

    MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA

    , of Human SHB (NP_003019)

  • Positive control
    • HepG2 cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab98007 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 55 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    Adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. May play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling. May also play a role in T-cell antigen receptor/TCR signaling, interleukin-2 signaling, apoptosis and neuronal cells differentiation by mediating basic-FGF and NGF-induced signaling cascades. May also regulate IRS1 and IRS2 signaling in insulin-producing cells.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Contains 1 SH2 domain.
  • Domain
    The SH2 domain preferentially binds phosphopeptides with the consensus sequence Y-[TVI]-X-L and mediates interaction with PDGFRA, PDGFRB, FGRFR1, IL2RB, IL2RG, CD3Z and CRK/CrKII.
  • Post-translational
    modifications
    Phosphorylated upon PDGFRA, PDGFRB, TCR, IL2 receptor, FGFR1 or VEGFR2 activation.
  • Cellular localization
    Cytoplasm. Cell membrane. Associates with membrane lipid rafts upon TCR stimulation.
  • Information by UniProt
  • Database links
  • Alternative names
    • bA3J10.2 antibody
    • OTTHUMP00000021397 antibody
    • RP11 3J10.8 antibody
    • RP113J10.8 antibody
    • SH2 domain containing adapter protein B antibody
    • SH2 domain-containing adapter protein B antibody
    • SHB (Src homology 2 domain containing) adaptor protein B antibody
    • SHB adaptor protein (a Src homology 2 protein) antibody
    • SHB adaptor protein antibody
    • Shb antibody
    • SHB_HUMAN antibody
    • Src homology 2 domain containing adaptor protein B antibody
    • Src homology 2 protein antibody
    see all

Anti-SHB antibody images

  • Anti-SHB antibody (ab98007) at 1 µg/ml (in 5% skim milk/ PBS buffer) + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 55 kDa

References for Anti-SHB antibody (ab98007)

ab98007 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98007.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up