Overview

  • Product nameAnti-SHC2 antibody
  • Description
    Mouse monoclonal to SHC2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment, corresponding to amino acids 718-830 of Human SHC2

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferPreservative: None
    PBS, pH 7.2
  • Concentration information loading...
  • PurityProtein G purified
  • ClonalityMonoclonal
  • IsotypeIgG2a
  • Light chain typekappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab57019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB
  • Application notesWB: Use at a concentration of 1-5 µg/ml.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.
  • Target

    • RelevanceSignaling adapter that couples activated growth factor receptors to signaling pathway in neurons. Involved in the signal transduction pathways of neurotrophin-activated Trk receptors in cortical neurons
    • Database links
    • Alternative names
      • Protein Sck antibody
      • SCK antibody
      • SH2 domain protein C2 antibody
      • SHC transforming protein 2 antibody
      • SHCB antibody
      • Src homology 2 domain containing transforming protein C2 antibody
      see all

    Anti-SHC2 antibody images



    • Predicted band size : 59 kDa
      SHC2 antibody (ab57019) at 1ug/lane + IMR-32 cell lysate at 25ug/lane.

    References for Anti-SHC2 antibody (ab57019)

    ab57019 has not yet been referenced specifically in any publications.

    Product Wall

    Vielen Dank für Ihren Anruf. Hiermit schicke ich Ihnen die Immunogensequenz von ab57019 (Anti-SHC2 antibody): LALTQPCALTALDQGPSPSLRDACSLPWDVGSTGTAPPGDGYVQADARGPPDHEEHLYVNTQGLDA PEPEDSPKKDLFDMRPFEDALKLHECSVAAGVTAAPLPLEDQWPSP Das Immunogen ist ...

    Read More

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"