Anti-SHCBP1 antibody - C-terminal (ab195311)

Overview

  • Product name
    Anti-SHCBP1 antibody - C-terminal
    See all SHCBP1 primary antibodies
  • Description
    Rabbit polyclonal to SHCBP1 - C-terminal
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
    Unsuitable for: IP
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human SHCBP1 aa 622-672 (C terminal). The exact sequence is proprietary.
    Sequence:

    STQKGQIKKKRLSELGITQADDNLMSQEMFVGIVGNQFKWNGKGSFGTFL F


    Database link: Q8NEM2

  • Positive control
    • HeLa, 293T and Jurkat cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab195311 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2500. Predicted molecular weight: 76 kDa.
  • Application notes
    Is unsuitable for IP.
  • Target

    • Function
      May play a role in signaling pathways governing cellular proliferation, cell growth and differentiation. May be a component of a novel signaling pathway downstream of Shc. Acts as a positive regulator of FGF signaling in neural progenitor cells.
    • Sequence similarities
      Contains 5 PbH1 repeats.
    • Information by UniProt
    • Database links
    • Alternative names
      • FLJ22009 antibody
      • PAL antibody
      • Protein expressed in Activated Lymphocytes antibody
      • SHC binding and spindle associated 1 antibody
      • SHC SH2 domain-binding protein 1 antibody
      • SHCBP_HUMAN antibody
      • Shcbp1 antibody
      see all

    Images

    • All lanes : Anti-SHCBP1 antibody - C-terminal (ab195311) at 1 µg/ml

      Lane 1 : HeLa cell lysate
      Lane 2 : 293T cell lysate
      Lane 3 : Jurkat cell lysate

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique.

      Predicted band size: 76 kDa


      Exposure time: 3 minutes

    References

    ab195311 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab195311.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

    Sign up