
  • Product nameAnti-SHOX2 antibody
    See all SHOX2 primary antibodies
  • Description
    Rabbit polyclonal to SHOX2
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human, Zebrafish
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide, corresponding to a region within internal sequence amino acids 179 - 228 (SEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPYVNVGAL R) of Human SHOX2, (NP_006875)

  • Positive control
    • 721_B cell lysate



Our Abpromise guarantee covers the use of ab82918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 35 kDa.Can be blocked with Human SHOX2 peptide (ab105429). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

ELISA titre using peptide based assay: 1/62500.


  • FunctionMay be a growth regulator and have a role in specifying neural systems involved in processing somatosensory information, as well as in face and body structure formation.
  • Tissue specificityExpressed in heart, skeletal muscle, liver, lung, bone marrow fibroblast, pancreas and placenta.
  • Sequence similaritiesBelongs to the paired homeobox family. Bicoid subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stageExpressed during cranofacial development as well as in heart.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • Homeobox protein Og12X antibody
    • OG 12 antibody
    • OG 12X antibody
    • OG12 antibody
    • OG12X antibody
    • OGI 2X antibody
    • OGI2X antibody
    • Paired related homeobox protein SHOT antibody
    • Paired-related homeobox protein SHOT antibody
    • Short stature homeobox 2 antibody
    • Short stature homeobox homolog antibody
    • Short stature homeobox protein 2 antibody
    • SHOT antibody
    • SHOX 2 antibody
    • SHOX homologous gene on chromosome 3 antibody
    • SHOX2 antibody
    • SHOX2_HUMAN antibody
    see all

Anti-SHOX2 antibody images

  • Anti-SHOX2 antibody (ab82918) at 1 µg/ml + 721_B cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 35 kDa
    Observed band size : 40 kDa (why is the actual band size different from the predicted?)
    Additional bands at : 20 kDa. We are unsure as to the identity of these extra bands.
  • All lanes : Anti-SHOX2 antibody (ab82918) at 1 µg/ml

    Lane 1 : Marker
    Lane 2 : Zebrafish brain homogenate at 20 µg
    Lane 3 : Zebrafish heart homogenate at 20 µg
    Lane 4 : Zebrafish liver homogenate at 20 µg

    Goat polyclonal to Rabbit IgG – H&L – Pre-Adsorbed (HRP) at 1/6000 dilution
    Developed using the ECL technique

    Performed under reducing conditions.

    Predicted band size : 35 kDa
    Observed band size : 41 kDa (why is the actual band size different from the predicted?)

    Exposure time : 5 minutes

References for Anti-SHOX2 antibody (ab82918)

ab82918 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab82918.
Please use the links above to contact us or submit feedback about this product.