Overview

  • Product nameAnti-SIAH1 antibody
    See all SIAH1 primary antibodies
  • Description
    Mouse monoclonal to SIAH1
  • Tested applicationsSuitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment (GST-tag) corresponding to Human SIAH1 aa 1-110.
    Sequence:

    MSRQTATALPTGTSKCPPSQRVPALTGTTASNNDLASLFECPVCFDYVLP PILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKY ASSGCEITLP


    Database link: Q8IUQ4

  • Positive control
    • Partial tagged recombinant Human SIAH1 protein (Immunogen); Jurkat cell lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab90556 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 31 kDa.
ELISA Use at an assay dependent dilution.

Target

  • FunctionE3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates E3 ubiquitin ligase activity either through direct binding to substrates or by functioning as the essential RING domain subunit of larger E3 complexes. Triggers the ubiquitin-mediated degradation of many substrates, including proteins involved in transcription regulation (MYB, POU2AF1, PML and RBBP8), a cell surface receptor (DCC), the cell-surface receptor-type tyrosine kinase FLT3, the cytoplasmic signal transduction molecules (KLF10/TIEG1 and NUMB), an antiapoptotic protein (BAG1), a microtubule motor protein (KIF22), a protein involved in synaptic vesicle function in neurons (SYP), a structural protein (CTNNB1) and SNCAIP. Confers constitutive instability to HIPK2 through proteasomal degradation. It is thereby involved in many cellular processes such as apoptosis, tumor suppression, cell cycle, axon guidance, transcription regulation, spermatogenesis and TNF-alpha signaling. Has some overlapping function with SIAH2. Induces apoptosis in cooperation with PEG3. Upon nitric oxid (NO) generation that follows apoptotic stimulation, interacts with S-nitrosylated GAPDH, mediating the translocation of GAPDH to the nucleus. GAPDH acts as a stabilizer of SIAH1, facilitating the degradation of nuclear proteins.
  • Tissue specificityWidely expressed at a low level. Down-regulated in advanced hepatocellular carcinomas.
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesBelongs to the SINA (Seven in absentia) family.
    Contains 1 RING-type zinc finger.
    Contains 1 SIAH-type zinc finger.
  • DomainThe RING-type zinc finger domain is essential for ubiquitin ligase activity.
    The SBD domain (substrate-binding domain) mediates the homodimerization and the interaction with substrate proteins. It is related to the TRAF family.
  • Post-translational
    modifications
    Phosphorylated on Ser-19 by ATM and ATR. This phosphorylation disrupts SIAH1 interaction with HIPK2, and subsequent proteasomal degradation of HIPK2.
  • Cellular localizationCytoplasm. Nucleus. Predominantly cytoplasmic. Partially nuclear.
  • Information by UniProt
  • Database links
  • Alternative names
    • E3 ubiquitin-protein ligase SIAH1 antibody
    • FLJ08065 antibody
    • hSIAH1 antibody
    • HUMSIAH antibody
    • Seven in absentia homolog 1 (Drosophila) antibody
    • Seven in absentia homolog 1 antibody
    • Siah 1 antibody
    • Siah 1a antibody
    • Siah E3 ubiquitin protein ligase 1 antibody
    • Siah-1 antibody
    • Siah-1a antibody
    • Siah1 antibody
    • SIAH1_HUMAN antibody
    • SIAH1A antibody
    • Ubiquitin ligase SIAH1 antibody
    see all

Anti-SIAH1 antibody images

  • Anti-SIAH1 antibody (ab90556) at 5 µg/ml + Partial tagged recombinant Human SIAH1 protein at 0.2 µg

    Predicted band size : 31 kDa
  • Anti-SIAH1 antibody (ab90556) at 5 µg/ml + Jurkat cell lysate at 50 µg

    Predicted band size : 31 kDa

References for Anti-SIAH1 antibody (ab90556)

ab90556 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90556.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"