Anti-SIAH3 antibody - N-terminal (ab177739)

Overview

  • Product name
    Anti-SIAH3 antibody - N-terminal
    See all SIAH3 primary antibodies
  • Description
    Rabbit polyclonal to SIAH3 - N-terminal
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Horse, Cat, Dog
  • Immunogen

    Synthetic peptide within Human SIAH3 aa 46-95 (N terminal). The exact sequence is proprietary.
    Sequence:

    YVSSRRAVTQSAPEQGSFHPHHLSHHHCHHRHHHHLRHHAHPHHLHHQEA


    Database link: Q8IW03

  • Positive control
    • Human fetal brain lysate

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab177739 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 30 kDa.

Target

Images

  • Anti-SIAH3 antibody - N-terminal (ab177739) at 1 µg/ml + Human fetal brain lysate at 10 µg

    Predicted band size : 30 kDa

References

ab177739 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177739.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up