Anti-Signal sequence receptor delta antibody [AT26G5] (ab180262)

Overview

  • Product name
    Anti-Signal sequence receptor delta antibody [AT26G5]
    See all Signal sequence receptor delta primary antibodies
  • Description
    Mouse Monoclonal [AT26G5] to Signal sequence receptor delta
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human Signal sequence receptor delta aa 24-144. Topological domain (lumenal) purified from E. coli.
    Sequence:

    EACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADVGGK QFPVTRGQDVGRYQVSWSLDHKSAHAGTYEVRFFDEESYSLLRKAQRNNE DISIIPPLFTVSVDHRGTWNG


    Database link: P51571

  • Positive control
    • MCF7 lysate.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: 10% Glycerol, 89% PBS
  • Concentration information loading...
  • Purity
    Protein G purified
  • Clonality
    Monoclonal
  • Clone number
    AT26G5
  • Isotype
    IgG1
  • Light chain type
    kappa
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab180262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 19 kDa.

Target

  • Relevance
    Signal sequence receptor delta is assumed to be involved in protein secretion. It is located in the Xq28 region, arranged in a compact head-to-head manner with the IDH3G gene. These two genes are driven by a bidirectional promoter located between them, and encode proteins involved in unrelated biochemical pathways located in different compartments of the cell. The nontranscribed intergenic region represents only 133 bp and is embedded in a CpG island. The CpG island functions as a bidirectional promoter to initiate the transcription of both functionally unrelated genes with distinct expression patterns. Signal sequence receptor delta consists of six exons and is approximately 70 kb telomeric to the ALD gene. Although alternative splicing of exon 5 has not been detected in human Signal sequence receptor delta, transcript variants missing the region homologous to human exon 5 have been detected in both Xenopus laevis and Mus musculus.
  • Cellular localization
    Endoplasmic reticulum
  • Database links
  • Alternative names
    • signal sequence receptor delta antibody
    • Signal sequence receptor subunit delta antibody
    • SSR delta antibody
    • SSR4 antibody
    • translocon associated protein delta antibody
    • TRAP delta antibody
    • TRAPD antibody
    see all

Images

  • Anti-Signal sequence receptor delta antibody [AT26G5] (ab180262) at 1000 + MCF7 lysate at 40 µg

    Secondary
    goat anti-mouse secondary antibody conjugated to HRP
    Developed using the ECL technique

    Predicted band size : 19 kDa

References

ab180262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up